KEGG   Bacillus subtilis subsp. subtilis 168: BSU19730
Entry
BSU19730          CDS       T00010                                 

Gene name
yodS
Definition
(RefSeq) coenzyme A transferase subunit alpha
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CoA_trans Thioredoxin_3
Other DBs
NCBI-GeneID: 940052
NCBI-ProteinID: NP_389854
Pasteur: BG13545
BSORF: BG13545
UniProt: O34317
Position
complement(2143660..2144349)
AA seq 229 aa
MAPFQKAISIDTAIADVRDGSVLMFGGFGGVGSPPSLIEAILDSGVTDLTVICNDAGFPD
IGIGPLIVNQRVKTLIASHIGSNPVAGKQMTEGTLEVQFSPQGTLAERIRAGGAGLGGIL
TDVGIDNQMVCEKKDIVTVAGKRYLIEEALTADFAFINAYIADEFGNLTYDKTARNMNPL
MAMAARRTFAEAERIVPMGEISEEMIVTPGVFVEGVVRSEGVKWKWAWE
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgccatttcaaaaagcaatcagcattgacacagcaattgcagatgttcgggatgga
tcggttctgatgtttggcggttttgggggagtcgggtcgcctccttcattgattgaagcg
atattggacagcggtgtaacggatttgactgtgatttgcaatgacgccggtttcccggat
atcggaatcggcccgcttattgttaatcaacgggtcaaaaccctgatcgcctcgcatatc
ggttccaatccagtagccggaaaacagatgacagaggggacgttagaggttcaattttca
cctcagggaacgcttgcggaacggattcgcgccggcggagcggggcttggcggtatttta
accgacgtgggcattgataatcaaatggtttgcgaaaaaaaggacatcgtaacagtggcg
ggaaaacgatacttgattgaagaggcgctgactgctgattttgctttcatcaatgcttac
attgcagatgaattcggcaatctaacgtatgacaaaaccgcgcgcaatatgaacccgctt
atggcaatggccgccaggagaacctttgccgaagctgagcgtatcgttccgatgggggag
atttctgaagaaatgattgtcacaccgggggtttttgttgagggggttgtacgaagcgag
ggagtgaagtggaaatgggcttgggagtag

DBGET integrated database retrieval system