KEGG   Bacillus subtilis subsp. subtilis 168: BSU19740
Entry
BSU19740          CDS       T00010                                 

Gene name
yodT
Definition
(RefSeq) aminotransferase YodT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aminotran_3 ZapA
Other DBs
NCBI-GeneID: 940050
NCBI-ProteinID: NP_389855
Pasteur: BG13546
BSORF: BG13546
UniProt: O34662
Position
complement(2144356..2145690)
AA seq 444 aa
MSSYLIKPELSSAYPVVSYAKGSYVYDQTGKKYLDGSSGAVTCNIGHGVRDVTEKLKEQL
DQVSFAYRSQFTSEPAEQLAALLAQELPGDVNWSFFVNSGSEAIETAMKIAIQYWQEKKQ
TQKSIFLSRWSSYHGITLGALSLSGFYERRYRFTHLIERYPAISAPHIYRLNHETEEDFV
QTAADELDTMIKRIGSQFIAGFVAEPIIGAAGAAITPPPGYYERLSEVCRTHDVLFIADE
VMTGLGRTGRMLATEHWDTVPDIAVLGKGLGAGYAPIAAAVVSDSIIETIKQGSGVIMSG
HTYSAHPYSAKAALEVLRYVLKHGLIKQSEKKGAVLKKKLDEAASQSGIIGEVRGKGLLL
GIEFVADQKTKKVFPPEQAITQLIVSEAKKRGLIVYPSKAGIDSGEGDAVIIAPPFTISD
GEMEELISIFSETVAAVEKNLKKD
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagcagttatttgattaagccagagcttagctcggcctatccggttgtcagttatgcg
aagggttcatatgtttatgatcagaccggaaaaaaatatctcgacggctcgtcaggtgcg
gtgacatgtaatatcggccacggagttcgtgatgtgactgagaagctgaaagaacagctt
gatcaggtgtcttttgcttaccgctcacagtttacgagtgagcccgccgagcaattagcc
gctctcttggcacaggagctgcccggagatgtgaattggtctttttttgtcaacagcgga
tcagaagcgatagaaacagctatgaaaatcgccattcagtattggcaggaaaaaaagcaa
acacaaaaatccatctttttgtctcgatggagcagttaccacggaataactttgggagcg
ctttcattgtctggtttttatgaaaggagataccggttcacccatctcattgagcggtat
ccagctatctcagctccacatatttatcggctgaatcacgagacggaagaagactttgtt
cagactgcagctgatgaactggacaccatgattaaaagaatcggaagccaattcatcgcc
ggctttgtggctgagcctattattggtgctgcaggagcagcgattactccgcctccggga
tattatgagagattaagtgaggtatgccgcacacacgatgtgctttttattgcagatgaa
gtgatgacggggcttgggagaacaggaaggatgctcgcgacagagcattgggataccgta
cctgatattgctgtactggggaagggactcggtgcggggtatgcacctattgctgctgcc
gtcgtatctgattctattattgaaaccataaaacaagggtcaggtgtgattatgagcggt
cacacatatagtgcacatccctattcagccaaagctgctcttgaagttttgcgatatgtg
ttaaagcacggcttgatcaaacaatcagaaaaaaagggcgctgtgctgaagaagaagctt
gatgaggcggcatctcaaagcggcattataggtgaggtgcgcggaaaaggactgctatta
ggcattgaatttgtggcagaccaaaaaacgaagaaagtgtttccgccagagcaggcgata
acccagcttattgtcagcgaggcgaaaaaacgcgggctgattgtttatccttccaaagct
ggaatagacagtggagaaggagatgctgtcattattgctcctccttttactatttcagac
ggtgaaatggaagagcttatctctattttttcagaaacagttgcagcggtcgaaaaaaac
ttaaaaaaggattga

DBGET integrated database retrieval system