KEGG   Bacillus subtilis subsp. subtilis 168: BSU19750
Entry
BSU19750          CDS       T00010                                 

Gene name
cgeE
Definition
(RefSeq) N-acetyltransferase CgeE
  KO
K06323  spore maturation protein CgeE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19750 (cgeE)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 FR47 Acetyltransf_7 Acetyltransf_CG Acetyltransf_16 Acetyltransf_3 Acetyltransf_9
Other DBs
NCBI-GeneID: 940064
NCBI-ProteinID: NP_389856
Pasteur: BG11197
BSORF: BG11197
UniProt: P42093
Position
complement(2146013..2146792)
AA seq 259 aa
MTGHYSKTEHQYILLTSESASFDHYSVYRDPQLPQIFSHNFVQLHDTFPLERLLNFLPSV
PKLLDANYLHLKASPQHVFPLGLKQSLVKSGFVVEDELLYDMKLSDWKGQMGHPLTAWGT
AKSLSDGSSIMKIYDSIYIGEAIAEQKLKRKYPFYEADIIILVVCYSDQAQKVPIGCGEL
FIDHQEKTAKIEEVAILDQFQRKGYGSILVKEMLSIAKSLGMEAAYLVAASTDGATQFYE
KLTFKKYERVHTVFHYFLT
NT seq 780 nt   +upstreamnt  +downstreamnt
atgacaggacattattcaaaaacggaacatcaatatatattgttaacgtctgaatcggca
tcgtttgatcattacagcgtatacagagatccgcagcttccgcaaattttttctcataac
tttgttcagctccatgatacgtttccattggagcggttacttaactttttaccctccgta
ccaaagctgcttgatgcgaattatctccatttaaaagcgtcgccgcagcatgtttttccg
ctcggtttgaagcagtcacttgtaaaaagcggttttgtcgtcgaggatgagctactatat
gacatgaagcttagtgactggaaggggcagatgggacatcctttaaccgcatgggggacg
gcaaaaagtcttagcgacggatcttctattatgaaaatttacgattccatttatattgga
gaagcaatcgctgaacaaaaattaaaaagaaaatatcctttctatgaagcagatataatc
attcttgttgtttgttacagcgaccaggcacagaaagttcccattgggtgcggcgagctg
tttatcgatcatcaagagaaaacggctaaaatcgaagaagtggcaattttagatcagttt
caaaggaagggctacggcagtatcttagtgaaagaaatgctgtccatcgccaaatcacta
ggaatggaagcagcctacttagtggctgcaagcactgacggtgcaactcagttttacgaa
aagctgacgtttaaaaaatatgagcgggtgcatactgtatttcattatttccttacatga

DBGET integrated database retrieval system