KEGG   Bacillus subtilis subsp. subtilis 168: BSU19760
Entry
BSU19760          CDS       T00010                                 

Gene name
cgeD
Definition
(RefSeq) spore maturation protein CgeD
  KO
K06322  spore maturation protein CgeD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19760 (cgeD)
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 940063
NCBI-ProteinID: NP_389857
Pasteur: BG11196
BSORF: BG11196
UniProt: P42092
Position
complement(2146821..2148101)
AA seq 426 aa
MGEKVSIILTSYNKPDYLQKAIESVIQQTHDLWELFIMDDHSNAETTAVIHKYLHDRRIQ
YHNSFVHPADRLKTARYATLINSALPFADGDYISYLTDDTVYHPERLSRMVQEFSHKPEA
QAVYSKQKVVHVNERGEEISHFYRNANAVLDQAAFQVDHCSVMHRRSLLNLIHHKFGGYW
DDDMKHWNHGDAIFWARLNNFTPFLPINEVLDTTYKTPDSFQNAYRFLPADLIDGSFVKG
SDQNVYFFDQGVRHPVGEKWGFLYLNRTVAVPDPYLFQYRIGKILNIPNYILVKEADHPA
IFYIEAGKKRRIVDQYAFQFYQFQRKDIVTIGKEEMETLPEGPPITWKRSELIKNPPGRR
LFFIEREPFLFLNGVFHPISEQVTRKFFLHQKPISASFRNIQQFPIGKPFYPVYDEIIKK
LNIATE
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgggagagaaagtgtctattattttaacaagttacaacaaacccgattatttgcaaaaa
gcgatcgaaagcgtgatacagcaaacgcatgatctttgggagctttttatcatggatgat
cattcgaatgcagaaacaactgcggtgattcacaagtatctccatgaccggcgcattcaa
tatcataacagtttcgtgcatcctgcagatcgattaaaaacagcccgttatgccacatta
attaacagtgcgctcccatttgcagacggcgattacatttcctatcttactgacgacact
gtttatcatcctgagcggctgagccgtatggtgcaagagttttcacataagcctgaagcg
caggcggtctattcaaaacaaaaagttgtacatgtaaacgaaaggggagaggaaatctca
catttctacagaaatgccaatgcagtgcttgatcaggccgcttttcaagttgatcattgc
tcagttatgcatcgccgttcgttacttaatctcattcaccataaatttggaggctactgg
gatgatgatatgaagcattggaatcatggcgacgcaattttttgggcgagactcaacaac
tttaccccatttctgccgataaatgaagtattagacacaacctataaaaccccagattca
tttcaaaatgcatatcggtttctgcccgccgatttgattgacggctcttttgtaaaaggt
tcagatcaaaatgtgtatttttttgatcagggtgtaaggcatcctgttggagaaaagtgg
ggttttttgtatctaaatcggactgtcgctgttccagacccatatttattccaatatagg
attggcaaaattttaaacattccgaattatattttagtaaaggaagctgaccatcctgca
atattttatatcgaagccggaaaaaaaaggcgaattgtggaccagtatgcgtttcaattt
tatcaatttcaaagaaaagacatagtgacaattggaaaagaagagatggagacgcttccg
gaagggccgccgattacgtggaaacgatctgaattgatcaaaaatccgcctggccgacgt
ctgtttttcatcgaacgcgagccgtttttgtttctaaacggcgtctttcacccgattagt
gaacaagtaacaaggaagttttttttacatcagaagccaatctccgcttctttccgaaat
attcagcaatttccaattggaaagccgttttatccggtgtacgatgagattataaagaaa
ttgaatattgcaacagagtaa

DBGET integrated database retrieval system