KEGG   Bacillus subtilis subsp. subtilis 168: BSU19770
Entry
BSU19770          CDS       T00010                                 

Gene name
cgeC
Definition
(RefSeq) spore maturation protein CgeC
  KO
K06321  spore maturation protein CgeC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19770 (cgeC)
SSDB
Other DBs
NCBI-GeneID: 940074
NCBI-ProteinID: NP_389858
Pasteur: BG11195
BSORF: BG11195
UniProt: P42091
Position
complement(2148166..2148471)
AA seq 101 aa
MDLEKQVDREENQDDLHFILLLLILLIRQSSSEGNPSDLRRQLVFAKELGVPVSKVNLIN
GDTLQNVIVKEVLTDLVIFQNPLNNTRSHVSLSSVVSWGAF
NT seq 306 nt   +upstreamnt  +downstreamnt
ttggatttagagaaacaagtggatcgagaagaaaaccaagatgatctgcattttattttg
cttttgctgattctgctgatacgtcaatcgtcttctgaaggaaatccatctgacctcaga
cgccagcttgtttttgcaaaagagctgggcgtaccggtttcaaaagtcaatttgatcaac
ggagatacacttcaaaatgtcatcgtaaaagaagttctgactgatttggttattttccaa
aacccgttaaataacacgagatctcatgtttcactctcaagtgttgtaagctggggtgct
ttttaa

DBGET integrated database retrieval system