KEGG   Bacillus subtilis subsp. subtilis 168: BSU19790
Entry
BSU19790          CDS       T00010                                 

Gene name
cgeB
Definition
(RefSeq) spore maturation protein CgeB
  KO
K06320  spore maturation protein CgeB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19790 (cgeB)
SSDB
Motif
Pfam: DUF3880 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 940061
NCBI-ProteinID: NP_389860
Pasteur: BG11194
BSORF: BG11194
UniProt: P42090
Position
2149084..2150037
AA seq 317 aa
MKVLYIQSGYGGIYSYFDRWAEECFQNTHTEYMIADKPEAESLMKIEAFQPDFTLMMVGD
RVPHDWLTWLKGKDIPVYVWLTEDPFYMDISLQVIKLADAILTIEQNAALYYQELGYQNV
YYVPIPVNHRLFKKMGTEHSYHSNLLIIGYPYPNRVQLMKEAVHLPFTVRVIGKEWGKYL
PKKVLKQPHIDVVSTWVPPEQAVHYYNGADIVINAHRPYHFAFNQNTMRIKNASFNNRTF
DIAACEAFQLTDLPAAHPFSSIISYHGMNDFKEKAAFYINHPEERQKAAAANYKETVPAF
TFDELPAKLKAIHLALS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaagtcttgtatatccagtcgggatacggaggaatatacagttattttgatcgctgg
gctgaagaatgttttcagaacactcatacagagtatatgattgcagataaacctgaagca
gaatctttgatgaagatcgaagcgtttcagccggatttcacacttatgatggttggagac
cgcgttcctcacgactggctgacctggttaaagggtaaggatatccccgtgtatgtttgg
ctgaccgaagacccattttatatggatatcagccttcaggtaattaagcttgctgacgcc
atattaacgatagaacaaaatgcagctctctactatcaagagctcggctaccagaacgtc
tattatgttccgataccagttaaccatcggctgtttaaaaaaatgggcaccgaacattcc
tatcattcaaatctgttaatcatcggctatccttaccctaatcgggttcagcttatgaaa
gaagcggtccatctgccattcacggttcgggtaatcggcaaggaatggggaaaatatctg
cctaaaaaagtgctcaaacagccgcatattgatgtcgtcagcacatgggttccacccgaa
caggccgttcattattataatggggcagacatcgtaattaatgcgcatcgtccctatcat
tttgctttcaaccaaaatactatgcgcatcaaaaatgccagttttaataaccgaacgttt
gatatcgctgcatgcgaagcatttcaattaacagatttacccgcggcgcatcctttttca
tccattatttcttatcacggcatgaacgactttaaggaaaaagccgctttctatatcaac
caccctgaagaacggcaaaaagctgcagcagccaattataaagagaccgtacccgcattt
acgtttgatgagcttcctgcaaaactaaaagcgattcatctggcgctttcttga

DBGET integrated database retrieval system