KEGG   Bacillus subtilis subsp. subtilis 168: BSU19790
Entry
BSU19790          CDS       T00010                                 

Symbol
cgeB
Name
(RefSeq) spore maturation protein CgeB
  KO
K06320  spore maturation protein CgeB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19790 (cgeB)
SSDB
Motif
Pfam: DUF3880 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 940061
NCBI-ProteinID: NP_389860
Pasteur: BG11194
BSORF: BG11194
UniProt: P42090 A0A6M3ZCZ4
Position
2149084..2150037
AA seq 317 aa
MKVLYIQSGYGGIYSYFDRWAEECFQNTHTEYMIADKPEAESLMKIEAFQPDFTLMMVGD
RVPHDWLTWLKGKDIPVYVWLTEDPFYMDISLQVIKLADAILTIEQNAALYYQELGYQNV
YYVPIPVNHRLFKKMGTEHSYHSNLLIIGYPYPNRVQLMKEAVHLPFTVRVIGKEWGKYL
PKKVLKQPHIDVVSTWVPPEQAVHYYNGADIVINAHRPYHFAFNQNTMRIKNASFNNRTF
DIAACEAFQLTDLPAAHPFSSIISYHGMNDFKEKAAFYINHPEERQKAAAANYKETVPAF
TFDELPAKLKAIHLALS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaagtcttgtatatccagtcgggatacggaggaatatacagttattttgatcgctgg
gctgaagaatgttttcagaacactcatacagagtatatgattgcagataaacctgaagca
gaatctttgatgaagatcgaagcgtttcagccggatttcacacttatgatggttggagac
cgcgttcctcacgactggctgacctggttaaagggtaaggatatccccgtgtatgtttgg
ctgaccgaagacccattttatatggatatcagccttcaggtaattaagcttgctgacgcc
atattaacgatagaacaaaatgcagctctctactatcaagagctcggctaccagaacgtc
tattatgttccgataccagttaaccatcggctgtttaaaaaaatgggcaccgaacattcc
tatcattcaaatctgttaatcatcggctatccttaccctaatcgggttcagcttatgaaa
gaagcggtccatctgccattcacggttcgggtaatcggcaaggaatggggaaaatatctg
cctaaaaaagtgctcaaacagccgcatattgatgtcgtcagcacatgggttccacccgaa
caggccgttcattattataatggggcagacatcgtaattaatgcgcatcgtccctatcat
tttgctttcaaccaaaatactatgcgcatcaaaaatgccagttttaataaccgaacgttt
gatatcgctgcatgcgaagcatttcaattaacagatttacccgcggcgcatcctttttca
tccattatttcttatcacggcatgaacgactttaaggaaaaagccgctttctatatcaac
caccctgaagaacggcaaaaagctgcagcagccaattataaagagaccgtacccgcattt
acgtttgatgagcttcctgcaaaactaaaagcgattcatctggcgctttcttga

DBGET integrated database retrieval system