KEGG   Bacillus subtilis subsp. subtilis 168: BSU19800
Entry
BSU19800          CDS       T00010                                 

Gene name
phy
Definition
(RefSeq) 3-phytase
  KO
K01083  3-phytase [EC:3.1.3.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU19800 (phy)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.8  3-phytase
     BSU19800 (phy)
SSDB
Motif
Pfam: Phytase
Other DBs
NCBI-GeneID: 940065
NCBI-ProteinID: NP_389861
Pasteur: BG11198
BSORF: BG11198
UniProt: P42094
Position
complement(2150108..2151256)
AA seq 382 aa
MKVPKTMLLSTAAGLLLSLTATSVSAHYVNEEHHFKVTAHTETDPVASGDDAADDPAIWV
HEKHPEKSKLITTNKKSGLVVYDLDGKQLHSYEFGKLNNVDLRYDFPLNGEKIDIAAASN
RSEGKNTIEVYAIDGDKGKLKSITDPNHPISTNISEVYGFSLYHSQKTGAFYALVTGKQG
EFEQYEIVDGGKGYVTGKKVREFKLNSQTEGLVADDEYGNLYIAEEDEAIWKFNAEPGGG
SKGQVVDRATGDHLTADIEGLTIYYAPNGKGYLMASSQGNNSYAMYERQGKNRYVANFEI
TDGEKIDGTSDTDGIDVLGFGLGPKYPYGIFVAQDGENIDNGQAVNQNFKIVSWEQIAQH
LGEMPDLHKQVNPRKLKDRSDG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaggttccaaaaacaatgctgctaagcactgccgcgggtttattgcttagcctgaca
gcaacctcggtgtcggctcattatgtgaatgaggaacatcatttcaaagtgactgcacac
acggagacagatccggtcgcatctggcgatgatgcagcagatgacccggccatttgggtt
catgaaaaacacccggaaaaaagcaagttgattacaacaaataagaagtcagggctcgtt
gtgtatgatttagacggaaaacagcttcattcttatgagtttggcaagctcaataatgtc
gatctgcgctatgattttccattgaacggcgaaaaaattgatattgctgccgcatccaac
cggtccgaaggaaaaaatacaattgaagtatatgcaatagacggggataaaggaaaattg
aaaagcattacagatccgaaccatcctatttccaccaatatttctgaggtttatggattc
agcttgtatcacagccagaaaacaggagcattttacgcattagtgacaggcaaacaaggg
gaatttgagcagtatgaaattgttgatggtggaaagggttatgtaacagggaaaaaggtg
cgtgaatttaagttgaattctcagaccgaaggccttgttgcggatgatgagtacggaaac
ctatacatagcagaggaagatgaggccatctggaaatttaacgctgagcccggcggaggg
tcaaaggggcaggttgttgaccgtgcgacaggagatcatttgacagctgatattgaagga
ctgacaatctattatgcaccaaatggcaaaggatatctcatggcttcaagtcaaggaaat
aacagctatgcaatgtatgaacggcaggggaaaaatcgctatgtagccaactttgagatt
acagatggcgagaagatagacggtactagtgacacggatggtattgatgttctcggtttc
ggacttggcccaaaatatccgtacgggatttttgtggcgcaggacggcgaaaatattgat
aacggacaagccgtcaatcaaaatttcaaaattgtatcgtgggaacaaattgcacagcat
ctcggcgaaatgcctgatcttcataaacaggtaaatccgaggaagctgaaagaccgttct
gacggctag

DBGET integrated database retrieval system