KEGG   Bacillus subtilis subsp. subtilis 168: BSU19820
Entry
BSU19820          CDS       T00010                                 

Gene name
yotN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YodL DUF4227 SF3a60_bindingd
Other DBs
NCBI-GeneID: 940072
NCBI-ProteinID: NP_389863
Pasteur: BG13747
BSORF: BG13747
UniProt: O34850
Position
complement(2152086..2152262)
AA seq 58 aa
MEPYQRYEELKKKTIKVVQKENYSIRYITQDEASNDLDEFYKQFAQHLLEAALERKAE
NT seq 177 nt   +upstreamnt  +downstreamnt
ttggaaccttaccaacgttatgaggaattaaagaaaaaaacaataaaggtagtccagaaa
gaaaattacagtattcgatatataactcaggatgaagcaagtaatgacttagatgagttt
tataaacaatttgctcaacatttattagaagctgctctggaaaggaaggcagagtaa

DBGET integrated database retrieval system