KEGG   Bacillus subtilis subsp. subtilis 168: BSU19830
Entry
BSU19830          CDS       T00010                                 

Gene name
yotM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4365
Other DBs
NCBI-GeneID: 940081
NCBI-ProteinID: NP_389864
Pasteur: BG13746
BSORF: BG13746
UniProt: O34820
Position
complement(2152265..2152852)
AA seq 195 aa
MGANNQGKVFEANIEKSAADQKLFFYRIKDVNPMFLKRGAAVSKNKYDCFLFFKGYLFPF
ELKSTKSKSISFSEKIIKPQQIKYLREATQYPNIIPGFLFQFREPENKVYFVHINDFLTY
KNIAEKQLKHTYKNKVNKASIPIAICEEIGTEVRSMKKKVNYTYYLNKLCGELIKKEQSR
DKPLHTYNTPVKTGV
NT seq 588 nt   +upstreamnt  +downstreamnt
ttgggagcaaacaatcaagggaaagtttttgaagcgaacattgaaaaatctgcagcagat
caaaagttattcttttaccggattaaagatgttaacccaatgttcttgaaaagaggggca
gcagtatcaaaaaacaaatatgattgctttctgttctttaaggggtacttgttccccttt
gagcttaagtcgacaaaaagcaagtccatttccttcagcgagaaaatcataaagccgcag
cagattaaatatttaagggaagcaacacaatacccaaacataatccctggttttctgttt
caatttagagagccggaaaacaaagtttatttcgtacatattaatgatttccttacatat
aagaacatagctgaaaaacagttgaaacatacatataagaataaagtaaacaaagccagt
atcccgattgcgatttgtgaagaaatcggtactgaagtgcgctcgatgaaaaagaaagtg
aattatacatattatttaaacaagctttgcggggaactaattaagaaagaacagtcaaga
gacaaaccattacatacatataatactcctgtgaaaacgggggtgtag

DBGET integrated database retrieval system