KEGG   Bacillus subtilis subsp. subtilis 168: BSU19850
Entry
BSU19850          CDS       T00010                                 

Gene name
yotK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FliS PAS_3 DUF5327 KIP1
Other DBs
NCBI-GeneID: 939549
NCBI-ProteinID: NP_389866
Pasteur: BG13744
BSORF: BG13744
UniProt: O31866
Position
complement(2153171..2153356)
AA seq 61 aa
MNEAYHSIQTLLNKMDRQMKTVKEAIEEKDLQRAHRNLINLADNNEELMQEIRWVKKGTI
L
NT seq 186 nt   +upstreamnt  +downstreamnt
attaacgaggcttatcattcaattcaaacactgttaaacaagatggatagacaaatgaag
acagtgaaggaggccattgaagaaaaagatttgcaaagagcacatcgtaacttaattaac
ttggctgacaataatgaggaattaatgcaggaaataaggtgggtcaaaaagggaaccata
ttataa

DBGET integrated database retrieval system