KEGG   Bacillus subtilis subsp. subtilis 168: BSU19860
Entry
BSU19860          CDS       T00010                                 

Gene name
yotJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 940079
NCBI-ProteinID: NP_389867
Pasteur: BG13743
BSORF: BG13743
UniProt: O34699
Position
complement(2153440..2153652)
AA seq 70 aa
MCNRNVITIPYEEDMSKYSILHQVGGRIEYFQKEYSQYPMFAFDSEEDYNEYKCLIMQLK
KNKKVSSFSF
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtgtaatcgaaatgttattacaattccatatgaagaggatatgtcaaagtattcaata
ctacaccaggtaggggggcgaattgagtattttcaaaaagagtattcacaatatccaatg
ttcgcatttgatagtgaagaggattacaacgaatataaatgcttaataatgcagcttaaa
aagaataaaaaagtctctagtttctctttttaa

DBGET integrated database retrieval system