KEGG   Bacillus subtilis subsp. subtilis 168: BSU19870
Entry
BSU19870          CDS       T00010                                 

Gene name
yotI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Defensin_beta
Other DBs
NCBI-GeneID: 940078
NCBI-ProteinID: NP_389868
Pasteur: BG13742
BSORF: BG13742
UniProt: Q796A8
Position
complement(2153718..2154080)
AA seq 120 aa
MIEIFKDTGATHDLVYHSKINTFVWDVEFDIVLSDSKELNKCYFVKCFNPYRINGKCDFA
VSSIDIFSEGKRLLIENEFNFKITKAVHVATSKDVTEIVLHLSERISSPFPIVKEVVYLD
NT seq 363 nt   +upstreamnt  +downstreamnt
atgattgaaatttttaaagatacaggagctacccatgatttagtttatcattctaagatt
aacacgtttgtttgggatgtggaatttgacattgttttatcagacagtaaggaattaaat
aaatgttattttgtgaaatgctttaatccgtatcgaataaatggaaagtgtgattttgcg
gttagttcaatagatatattttccgaaggtaaacgtctcttaattgaaaatgaattcaat
tttaaaattacaaaggcagtccacgtggcaacatcaaaagacgtaactgaaatagttttg
catttaagtgagagaatcagtagtccatttccaattgtaaaagaagttgtttatctagat
taa

DBGET integrated database retrieval system