KEGG   Bacillus subtilis subsp. subtilis 168: BSU19880
Entry
BSU19880          CDS       T00010                                 

Gene name
yotH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 940084
NCBI-ProteinID: NP_389869
Pasteur: BG13741
BSORF: BG13741
UniProt: O31867
Position
complement(2154077..2154250)
AA seq 57 aa
MIVTAWILLIVFGLFALSDFDLTENETKHIKFFILMKFVSVFIAAIAAGVIWGGLFQ
NT seq 174 nt   +upstreamnt  +downstreamnt
ctgattgttacagcctggatattgttaattgtgtttggtttattcgctttatcagatttt
gacttaactgagaacgaaacaaagcatattaagtttttcattttaatgaaatttgtttct
gtctttatagctgctattgcagcaggagtgatttggggaggattatttcaatga

DBGET integrated database retrieval system