KEGG   Bacillus subtilis subsp. subtilis 168: BSU19890
Entry
BSU19890          CDS       T00010                                 

Gene name
yotG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Yos1
Other DBs
NCBI-GeneID: 940082
NCBI-ProteinID: NP_389870
Pasteur: BG13740
BSORF: BG13740
UniProt: O31868
Position
complement(2154266..2154583)
AA seq 105 aa
MKESLMIYFNIENSSDIHEFLKIAVAKNDVDYPFLEWIKEKGIPRLKNIDFNKLPNDDRF
LAMIEFDEFVLQNEMDFEDPEEVRGCIISTVNSLKEYINICHNKT
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaaggaaagtctcatgatttatttcaatattgaaaactcttctgatattcatgagttt
ttaaaaatcgcagtagcaaagaatgatgttgattatcccttccttgaatggataaaggaa
aaaggtattccaagattaaagaatattgattttaataagctacccaatgacgatcgcttt
cttgccatgattgagtttgatgaatttgttctgcaaaatgaaatggattttgaagatcct
gaagaggttcgagggtgtattatttcaacagttaatagcctgaaggaatatattaatatc
tgccacaataaaacatga

DBGET integrated database retrieval system