KEGG   Bacillus subtilis subsp. subtilis 168: BSU19920Help
Entry
BSU19920          CDS       T00010                                 

Gene name
yotD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HypA TackOD1 C1_2
Motif
Other DBs
NCBI-GeneID: 940092
NCBI-ProteinID: NP_389873
Pasteur: BG13737
BSORF: BG13737
UniProt: O34407
Position
complement(2154887..2155018)
Genome map
AA seq 43 aa AA seqDB search
MDSREQIDWTCNECNFSWIGDNSDFSCPSCDEIDIKPKNKILD
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagagaacaaattgattggacttgtaatgaatgcaattttagttggataggt
gacaattcagatttttcatgtccttcttgtgatgaaatcgatataaagccaaaaaataag
atacttgattga

DBGET integrated database retrieval system