KEGG   Bacillus subtilis subsp. subtilis 168: BSU19930
Entry
BSU19930          CDS       T00010                                 

Gene name
yotC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DZR HypA DUF1610 Zn-ribbon_8 zf-NADH-PPase DUF5319 RNA_POL_M_15KD
Other DBs
NCBI-GeneID: 940094
NCBI-ProteinID: NP_389874
Pasteur: BG13736
BSORF: BG13736
UniProt: O34702
Position
complement(2155058..2155249)
AA seq 63 aa
MENEVVFFCRKCNHHLFAKNPMINTLKVISEMDCPNCGEEGYHNWILSHIGDSEKEKENY
NWK
NT seq 192 nt   +upstreamnt  +downstreamnt
atggaaaatgaagttgtgtttttttgtagaaaatgcaatcatcacttgtttgctaaaaat
cctatgataaacacattaaaggttatatctgaaatggattgccctaattgtggagaagag
ggttatcataattggattctttcgcatataggtgattcagagaaagaaaaggagaactac
aattggaagtag

DBGET integrated database retrieval system