KEGG   Bacillus subtilis subsp. subtilis 168: BSU19940Help
Entry
BSU19940          CDS       T00010                                 

Gene name
yotB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 940114
NCBI-ProteinID: NP_389875
Pasteur: BG13735
BSORF: BG13735
UniProt: O34642
Position
complement(2155293..2156120)
Genome map
AA seq 275 aa AA seqDB search
MKIDYVSDLHINHWIPWNVNQIKWEKRTREIVNRLISNGNGEVLVIAGDFTEWNQQTLWV
LDEAAKQYEKVYFTYGNHDLYLLSKSQKRKYSDSLGRLNDLIQKAADMKNVTPLIKTTET
YKGKVFAGDVMWYLPKGIEGWDFFKGVSNDSNYIWLNGYNKVDGVRAMWKESMDWYETLE
NTQVDVFVSHVPPVHNPYSPFEPNTCYMVDVPFINAKHWVCGHDHLQAEFDKDGTSFHMN
CIGYPYDYDNYPSVNVIPGEEVDSYKTFELKTFEI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgattatgtttcagatctccatataaatcattggattccttggaatgtaaat
cagattaagtgggagaagcgaacaagagaaattgtaaataggttaatctcaaacggtaat
ggggaggtattggtcattgccggcgattttactgaatggaatcaacaaactttatgggtt
ttagatgaggcagcaaagcaatacgagaaggtttactttacatatggtaatcatgatctt
tatttacttagcaagagccaaaaaaggaaatactcagactcgttaggcaggttgaatgat
ctaattcaaaaagctgctgacatgaaaaatgtaacaccattaattaagacaactgaaaca
tacaaaggaaaagtctttgcaggagatgtaatgtggtaccttccaaaaggaatcgaagga
tgggacttctttaaaggagtatctaacgattctaattacatttggcttaatggttataac
aaagtagatggtgtaagagcgatgtggaaagaatcaatggattggtatgaaacgcttgaa
aatacacaagttgatgtatttgtctcacatgttccacctgttcacaatccttattctcca
tttgagcctaatacatgctacatggttgatgtcccgttcattaacgcaaaacactgggtt
tgtggacatgatcatttacaagctgagtttgacaaagatggaacgagctttcacatgaat
tgtatcggatacccgtatgactatgataattatccgagtgtcaatgtgatacctggtgaa
gaagtagattcatataaaacgtttgagcttaaaacattcgagatttag

DBGET integrated database retrieval system