KEGG   Bacillus subtilis subsp. subtilis 168: BSU19950
Entry
BSU19950          CDS       T00010                                 

Gene name
sspC
Definition
(RefSeq) small acid-soluble spore protein C
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU19950 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-GeneID: 939473
NCBI-ProteinID: NP_389876
Pasteur: BG10882
BSORF: BG10882
UniProt: P02958
Structure
PDB: 
2Z3X

Position
2156239..2156457
AA seq 72 aa
MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaagtagatcaagatcaaacaacaataatgatttactaattcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system