KEGG   Bacillus subtilis subsp. subtilis 168: BSU19970Help
Entry
BSU19970          CDS       T00010                                 

Gene name
yosX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939517
NCBI-ProteinID: NP_389878
Pasteur: BG13733
BSORF: BG13733
UniProt: P68583
Position
complement(2156757..2157110)
Genome map
AA seq 117 aa AA seqDB search
MEVGDKIHNTNEQITALEKKKYQIETTLLEKQRDLLKLETQQNKAKLELLFELSEVLTQL
EGEEWVSATIALRIIKRNKRKYLDLFDLNDDKAYVNKDKFKFLHDEFFELKQQLNDI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtaggagacaaaatacataacaccaacgaacagataacagccttagagaaaaag
aaataccaaattgaaacaactttacttgaaaaacaaagggatctgttaaaactcgaaaca
cagcaaaacaaagctaagcttgaattgttattcgagctaagtgaagtcttaacccaattg
gaaggtgaagagtgggtaagtgccactattgctttacgaattattaaaagaaataaaaga
aagtacttagatctctttgatcttaatgatgacaaagcatacgtaaataaggataaattt
aaatttcttcatgatgaattctttgagctgaaacaacaattaaatgatatctga

DBGET integrated database retrieval system