KEGG   Bacillus subtilis subsp. subtilis 168: BSU19980Help
Entry
BSU19980          CDS       T00010                                 

Gene name
yosW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 938813
NCBI-ProteinID: NP_389879
Pasteur: BG13732
BSORF: BG13732
UniProt: O31872
Position
complement(2157341..2157682)
Genome map
AA seq 113 aa AA seqDB search
MIMRGESNTYIKVKSVLDNSTPEDAKRNKNLIYLFTLLKGSSLIIPLAYNGLIMHENILI
LCWTAFSVIYTVLSMFKVLDVLEGETVSHSRYIYLAYVFGNLIFALSIIFHIM
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgcgaggggaaagcaatacgtatataaaagtaaagagtgtgcttgataattca
actccagaagatgcgaaacgaaataagaatttaatttacctgtttactttgcttaagggg
agttctttaatcatccccttggcatataacggtttaattatgcatgaaaatatccttata
ctctgttggacagcattttcagttatatacacagtcctaagcatgtttaaggttttagac
gtgttggagggcgaaacagtgagccatagtaggtatatttatttggcttatgtctttggg
aaccttatctttgctttgagtattatttttcatataatgtga

DBGET integrated database retrieval system