KEGG   Bacillus subtilis subsp. subtilis 168: BSU19990
Entry
BSU19990          CDS       T00010                                 

Gene name
yosV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: OrfB_IS605 DUF4041
Other DBs
NCBI-GeneID: 939523
NCBI-ProteinID: NP_389880
Pasteur: BG13731
BSORF: BG13731
UniProt: O34537
Position
complement(2157829..2158119)
AA seq 96 aa
MFKDKNKIIKSVEKINKLEEGLSLFEEGDEEYLSVLVKIQGLYDEISDTALECFKEMTTK
IRKTGQKRIIKGIDQLPHTIKENIADQVNDFKGGAI
NT seq 291 nt   +upstreamnt  +downstreamnt
ttgtttaaggataaaaataaaataataaagagtgttgaaaagatcaacaaacttgaagaa
gggttgtcgctatttgaagaaggtgacgaagaatatttaagtgtattagtgaaaattcag
gggctatatgatgaaatctcagatactgctttagagtgttttaaagagatgactacaaaa
attaggaaaactggtcagaaacggattataaaagggattgatcagttgccacatacaatt
aaagaaaacattgctgatcaagtgaatgattttaaagggggagctatttga

DBGET integrated database retrieval system