KEGG   Bacillus subtilis subsp. subtilis 168: BSU19999
Entry
BSU19999          CDS       T00010                                 

Gene name
yojW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nitrate_red_del
Other DBs
NCBI-GeneID: 8302977
NCBI-ProteinID: YP_003097747
UniProt: O30602
Position
complement(2158120..2158287)
AA seq 55 aa
MLYRNGLCFGFLQLQGLEDEFIEHMRQVAEYEKDLRYKKAAANFMKMHDQNWVGD
NT seq 168 nt   +upstreamnt  +downstreamnt
atgctttataggaacggtctttgctttgggtttcttcagttacaaggacttgaagatgaa
tttattgaacatatgagacaagttgctgagtacgagaaagacctgagatacaagaaggca
gcagctaacttcatgaagatgcatgaccaaaactgggtgggggattaa

DBGET integrated database retrieval system