KEGG   Bacillus subtilis subsp. subtilis 168: BSU20000
Entry
BSU20000          CDS       T00010                                 

Gene name
yosU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 7TMR-DISM_7TM Peptidase_M50B DUF4131
Other DBs
NCBI-GeneID: 939552
NCBI-ProteinID: NP_389881
Pasteur: BG13730
BSORF: BG13730
UniProt: O31873
Position
2158439..2158684
AA seq 81 aa
MRKILKIVSLLILLLLLVYSFFSPNSQLFVFVQLIIIAFLIGFGINCFVKKERYQGTLYF
VIAICNITINLDKINELIQSI
NT seq 246 nt   +upstreamnt  +downstreamnt
ttgcgaaaaatattaaaaatcgttagcttactgattctattgttattattggtttattct
ttcttcagtcctaattcacaattatttgtgttcgttcagctaatcataattgcatttttg
attggttttggaattaactgttttgttaaaaaagaacgataccaaggtactctatacttc
gtaattgcaatatgcaacattaccattaatcttgataaaataaacgagttaattcagagc
atttaa

DBGET integrated database retrieval system