KEGG   Bacillus subtilis subsp. subtilis 168: BSU20010
Entry
BSU20010          CDS       T00010                                 

Gene name
yosT
Definition
(RefSeq) transcriptional regulator YosT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GyrI-like Cass2
Other DBs
NCBI-GeneID: 939471
NCBI-ProteinID: NP_389882
Pasteur: BG13729
BSORF: BG13729
UniProt: O34775
Position
complement(2158724..2159173)
AA seq 149 aa
MKITIEELPELRIAYFRNVGEYGGKQNKELMESFKKWAQLNGVFHNSVILGIPQDDPSIT
PKEECRYDVGVVLNEDFNVLQPAQVGKLPGGKYAVFLLDHTKEAVSEFWGNIFSEIEKNS
LTMRGEPIIERYTSQMIDNHLCEVLVPIQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaaataactattgaagaattacctgaattaaggattgcttatttccgaaacgttgga
gagtatggtggtaagcaaaacaaagaactaatggaatcttttaaaaagtgggcacagttg
aatggtgtatttcataactctgtaattttaggaattccacaagatgatccaagtattact
cctaaagaggaatgccgttatgatgttggtgttgtattaaatgaagattttaatgtgctg
caaccagctcaagttggtaagttacctggagggaaatacgctgttttcttgcttgaccat
acaaaagaggcagtaagtgaattttggggcaatattttctctgaaatagaaaaaaatagt
ctaactatgagaggagaaccaattatagagagatatacttcacaaatgattgataatcac
ttatgtgaagtattagttcctatccaataa

DBGET integrated database retrieval system