KEGG   Bacillus subtilis subsp. subtilis 168: BSU20030
Entry
BSU20030          CDS       T00010                                 

Gene name
yosR
Definition
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Thioredoxin Glutaredoxin Thioredoxin_3 Thioredoxin_2 DUF836 KaiB Thioredoxin_8 DUF3898 OST3_OST6
Other DBs
NCBI-GeneID: 939513
NCBI-ProteinID: NP_389884
Pasteur: BG13727
BSORF: BG13727
UniProt: O34342
Position
complement(2159742..2159984)
AA seq 80 aa
MRLIKLEQPNCNPCKMVSNYLEQVNIQFETVDVTQEPEVAARFGVMGVPVTILLSDQGEE
VNRSVGFKPNELDELLKELR
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagattaattaaattagagcagcctaattgcaatccatgtaaaatggtgtccaattac
ttagaacaagtaaatattcaatttgagactgttgacgttacacaggaaccagaagtagca
gcaagatttggtgtcatgggagtaccggtaaccattctgctgagtgatcagggagaagaa
gtaaaccgaagtgttggttttaagcctaatgaacttgatgagttactaaaggaattacga
taa

DBGET integrated database retrieval system