KEGG   Bacillus subtilis subsp. subtilis 168: BSU20040Help
Entry
BSU20040          CDS       T00010                                 

Gene name
nrdF
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU20040 (nrdF)
   00240 Pyrimidine metabolism
    BSU20040 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU20040 (nrdF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU20040 (nrdF)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU20040 (nrdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF533
Motif
Other DBs
NCBI-GeneID: 939476
NCBI-ProteinID: NP_389886
Pasteur: BG13725
BSORF: BG13725
UniProt: O30601
Position
complement(join(2159981..2160388,2161197..2161778))
Genome map
AA seq 329 aa AA seqDB search
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLA
GLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFLTLAPTEQINE
VFEWVKNNRFLQKKARTIVSVYKTIKKNDEISLFKGMVASVFLESFLFYSGFYYPLYFYG
QGKLMQSGEIINLIIRDEAIHGVYVGLLAQEIYKKQTPQKQKELYAWALNLLQELYENEL
EYTEDVYDQVGLAPDVKKFIRYNANKALNNLGFDHWFEEEDVNPIVINGLNTKTKSHDFF
STKGNGYKKATVEPLKDSDFIFTEKGCIQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaaaatttatgacgcagcaaactggtcaaagcatgaagacgattttacccaaatg
ttctataaccaaaacgtgaaacagttctggcttccggaagagattgctttaaacggcgat
ctcctcacatggaagtacctcggaaaaaatgagcaggacacttatatgaaggtactggcc
ggacttacgcttcttgatacagagcaggggaatacggggatgccgatcgtggctgaacac
gtagatggacatcaaagaaaggcagttttaaatttcatggccatgatggaaaatgctgtt
catgcaaagtcttacagcaacatctttctaacattggctccaaccgagcagatcaatgaa
gtctttgaatgggtgaaaaacaataggtttcttcaaaagaaagctagaacaattgtttca
gtctataaaacaatcaagaaaaacgatgaaatttctttatttaaaggaatggttgcatct
gtgttcctggagagttttcttttctactcagggttttattacccactttatttttatgga
caaggaaagttaatgcaaagtggagagatcattaacctgattattagagacgaagcgata
catggcgtatatgtaggattgttagctcaagagatttataagaagcaaacgccacagaag
caaaaagaactgtacgcatgggctttaaacttactgcaggaactttacgaaaatgaattg
gagtatacagaagatgtctatgatcaggttggattagctccagatgtaaagaaattcatc
agatacaacgcaaataaagctttaaacaatctgggctttgatcattggtttgaagaagag
gatgttaatccaattgttatcaatggtttgaacactaagactaaatcccatgacttcttt
tcaactaaagggaatggatacaaaaaagcaacagtggagcctttaaaggattcagatttc
atttttaccgagaaaggatgtattcaatga

DBGET integrated database retrieval system