KEGG   Bacillus subtilis subsp. subtilis 168: BSU20050
Entry
BSU20050          CDS       T00010                                 

Gene name
yosQ
Definition
(RefSeq) HNH homing endonuclease YosQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HNH_3
Other DBs
NCBI-GeneID: 939514
NCBI-ProteinID: NP_389885
Pasteur: BG13726
BSORF: BG13726
UniProt: O34479 A0A6M3ZCT9
Position
complement(2160565..2161086)
AA seq 173 aa
MIRKEVEEAPWWITETGVIISKKLKKPRKTFITPHGYEMIGYTHPKKGTQNYLVHRLVAK
YFIYDIPKGMFVNHIDGNKLNNHVRNLEIVTPKENTLHAMKIGLMSGQPGESNSMSKLTN
MEATNLIYDLIAGMNNVEAGEKYSLHPRYVSLIRHKRRWKTLWDRIERSTTIA
NT seq 522 nt   +upstreamnt  +downstreamnt
atgataaggaaagaagtcgaagaagcaccttggtggataacggaaacgggagttatcata
tcaaaaaaattaaagaaaccaagaaagacatttattactccacatggctatgaaatgata
ggatacacgcatccgaaaaaaggaacacagaactatttagtacataggttagtcgcaaaa
tattttatttatgatataccaaaaggaatgtttgtaaaccacatagatggaaataaacta
aacaaccacgttcggaacttagaaatagttacacctaaagaaaatactctacatgcaatg
aaaattggattaatgtcaggacaacctggagaaagtaattcaatgtcaaagctcactaat
atggaggcaacaaatttaatctatgatttgattgctggaatgaacaatgttgaagctggt
gaaaaatacagccttcatcctcgttacgttagtctaattcgacataaaagaagatggaag
actttatgggatcgcatagaacgttcaacgactatcgcatag

DBGET integrated database retrieval system