KEGG   Bacillus subtilis subsp. subtilis 168: BSU20070Help
Entry
BSU20070          CDS       T00010                                 

Gene name
nrdI
Definition
(RefSeq) ribonucleotide reductase stimulatory protein NrdI
  KO
K03647  protein involved in ribonucleotide reduction
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    BSU20070 (nrdI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_NdrI Flavodoxin_3 Flavodoxin_1
Motif
Other DBs
NCBI-GeneID: 939562
NCBI-ProteinID: NP_389889
Pasteur: BG13722
BSORF: BG13722
UniProt: P68524
Position
complement(2165577..2165966)
Genome map
AA seq 129 aa AA seqDB search
MTYESKTGNVKRFVKALQQEFDVEAIEITDDTIINQEFIHITYTIGFGEVPERTLSFINK
NKNKIRGVAVSGNKVWGDNYGLAGDKLSAKFHTPLLLKFELSGTKQDLQKIIQEVQLIDK
HNTKLDQAQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
attacatatgagagtaaaacaggaaatgtaaaaaggtttgtcaaagcgctgcaacaagag
tttgacgttgaggcaattgaaataactgatgatacgatcatcaatcaagaattcatacat
attacatatacgataggctttggggaagtacctgaaaggactttgagttttatcaataag
aataaaaataaaattagaggagttgctgttagtggtaacaaggtttggggtgataactat
ggtttagctggagacaagctttcagctaagttccacacaccattgttattaaagtttgaa
cttagtggaacgaaacaagatctacagaaaatcattcaggaggtacaacttattgacaaa
cacaataccaaattggatcaagctcaataa

DBGET integrated database retrieval system