KEGG   Bacillus subtilis subsp. subtilis 168: BSU20090
Entry
BSU20090          CDS       T00010                                 

Gene name
yosK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939546
NCBI-ProteinID: NP_389891
Pasteur: BG13720
BSORF: BG13720
UniProt: O31878 A0A6M4JMY8
Position
complement(2166413..2166613)
AA seq 66 aa
MSQSNYRPSVPRWVGDILELDKKRRQNQYRGSLTSGQEKKDWDEWKRRYSRKLKYARLNG
WTIEEE
NT seq 201 nt   +upstreamnt  +downstreamnt
atgtcgcaaagtaattataggccgtcagttcctagatgggttggcgatatactagagcta
gacaagaaaagaagacaaaatcagtacagaggctcactaacgtcaggtcaagagaagaag
gactgggacgagtggaagcgtagatattcaagaaaattaaagtacgcaagattaaacgga
tggacgatcgaagaagagtga

DBGET integrated database retrieval system