KEGG   Bacillus subtilis subsp. subtilis 168: BSU20100Help
Entry
BSU20100          CDS       T00010                                 

Gene name
yosJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939556
NCBI-ProteinID: NP_389892
Pasteur: BG13719
BSORF: BG13719
UniProt: O31879
Position
complement(2166658..2166852)
Genome map
AA seq 64 aa AA seqDB search
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system