KEGG   Bacillus subtilis subsp. subtilis 168: BSU20110Help
Entry
BSU20110          CDS       T00010                                 

Gene name
yosI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939563
NCBI-ProteinID: NP_389893
Pasteur: BG13718
BSORF: BG13718
UniProt: O31880
Position
complement(2166873..2167007)
Genome map
AA seq 44 aa AA seqDB search
MKMKYGLYCMGSLVNTYDDAIEAHNDAVYAQEESGVPHEVREIQ
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaatatggactttattgtatgggatcacttgttaatacttatgatgatgca
attgaggctcataatgatgcagtatatgctcaagaagaaagcggagtaccgcatgaagta
agagaaattcaataa

DBGET integrated database retrieval system