KEGG   Bacillus subtilis subsp. subtilis 168: BSU20120
Entry
BSU20120          CDS       T00010                                 

Gene name
yosH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939551
NCBI-ProteinID: NP_389894
Pasteur: BG13717
BSORF: BG13717
UniProt: O31881 A0A6M3ZCN9
Position
complement(2167039..2167509)
AA seq 156 aa
MGIKAAVFEIKATCYAHEGFNDESPSVQGAALEQLGKDMVDHLLENGVDDVKIKGDYVEE
LEVEKPIMKYFEVFDPYYALIKAYTKEKAMELYTDTVTDDDDGELSDEMTEVGQVYAAIQ
HGRAPGEDKELMPFKQVLEEISNDEEMVLLIDGSLL
NT seq 471 nt   +upstreamnt  +downstreamnt
atgggaattaaagcagcagtttttgaaataaaagcaacttgttacgctcatgaaggattt
aatgacgaaagtccatctgttcaaggagcagcgttagaacaactaggcaaggatatggta
gatcatttgctcgaaaacggagttgatgatgtgaaaattaaaggcgattacgttgaggaa
ttggaagttgaaaaacccattatgaagtattttgaagtgtttgacccctattatgcattg
attaaggcttatacaaaagaaaaggcaatggaactgtatacagatactgttacagatgat
gatgatggagagttaagtgatgaaatgacagaagttgggcaagtttatgcggcgatacaa
catggaagggcgccaggagaagataaagagctcatgccgtttaaacaggttcttgaggag
atttctaatgacgaagagatggtattgcttattgatggcagtttactttaa

DBGET integrated database retrieval system