KEGG   Bacillus subtilis subsp. subtilis 168: BSU20130
Entry
BSU20130          CDS       T00010                                 

Gene name
yosG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939570
NCBI-ProteinID: NP_389895
Pasteur: BG13716
BSORF: BG13716
UniProt: O31882 A0A6M3ZHY1
Position
complement(2167570..2167932)
AA seq 120 aa
MILKEIAVYEETLNKHLPNETRMVLHYKNVEATENEDKITVRISNDLLVYKWVELGGVSK
GTYKMKMTSLEDETSEVNVKIERIQMNSDRDLAVEIEFNVLNPFQSVVGVPGIHSFSIKG
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatcttaaaagaaattgccgtatatgaagaaacactgaataaacatttaccaaatgaa
acaagaatggttcttcattacaaaaatgtagaggcaactgaaaacgaagataaaatcaca
gtaaggattagtaatgatttattggtttataaatgggttgaactaggcggtgtatctaag
ggcacttataaaatgaaaatgactagtctagaagatgaaacaagcgaagttaatgtgaaa
atcgaaagaattcaaatgaactcagacagagatttggcggtagaaatagaatttaatgtg
ctcaatccattccagagcgttgtgggtgtacctggtattcattcgttctccataaaagga
tga

DBGET integrated database retrieval system