KEGG   Bacillus subtilis subsp. subtilis 168: BSU20140
Entry
BSU20140          CDS       T00010                                 

Gene name
yosF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939526
NCBI-ProteinID: NP_389896
Pasteur: BG13715
BSORF: BG13715
UniProt: O31883 A0A6M3ZD25
Position
complement(2167975..2168100)
AA seq 41 aa
MSDDNAAKIIFKKKSTGKIVGEMKATSLAADTILQNDNKSK
NT seq 126 nt   +upstreamnt  +downstreamnt
atgagtgatgataatgctgcaaagattattttcaaaaagaaatcaactggtaaaattgtc
ggcgaaatgaaagctacatctttagctgctgacaccattttgcaaaacgacaataagtct
aaataa

DBGET integrated database retrieval system