KEGG   Bacillus subtilis subsp. subtilis 168: BSU20150
Entry
BSU20150          CDS       T00010                                 

Gene name
yosE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TraD
Other DBs
NCBI-GeneID: 939572
NCBI-ProteinID: NP_389897
Pasteur: BG13714
BSORF: BG13714
UniProt: O31884 A0A6M3ZCN6
Position
complement(2168114..2168461)
AA seq 115 aa
MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV
TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI
NT seq 348 nt   +upstreamnt  +downstreamnt
ttgaataaggatacaaaagatatttggagcggattctttatggggtcaggttcgttaatt
gtagttggattacttatttttgttgaagcgttgactatgtcactaattgtttattacgga
ttgaatcatgtgttaaatcctttgcttattgatacatacaatattcaaaatgtccatgtc
actttacctcatgcatttgttattggtgttttactcaatgtatttgtcaaaggtgtaaaa
cggtcagatcaggaaaaagatgagaacattttcaagaaagccggtaagtctttatttcat
tcaactttcgcattgattgttctatatgttagcacattgtttatctaa

DBGET integrated database retrieval system