KEGG   Bacillus subtilis subsp. subtilis 168: BSU20150Help
Entry
BSU20150          CDS       T00010                                 

Gene name
yosE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1453 TraD
Motif
Other DBs
NCBI-GeneID: 939572
NCBI-ProteinID: NP_389897
Pasteur: BG13714
BSORF: BG13714
UniProt: O31884
Position
complement(2168114..2168461)
Genome map
AA seq 115 aa AA seqDB search
MNKDTKDIWSGFFMGSGSLIVVGLLIFVEALTMSLIVYYGLNHVLNPLLIDTYNIQNVHV
TLPHAFVIGVLLNVFVKGVKRSDQEKDENIFKKAGKSLFHSTFALIVLYVSTLFI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaggatacaaaagatatttggagcggattctttatggggtcaggttcgttaatt
gtagttggattacttatttttgttgaagcgttgactatgtcactaattgtttattacgga
ttgaatcatgtgttaaatcctttgcttattgatacatacaatattcaaaatgtccatgtc
actttacctcatgcatttgttattggtgttttactcaatgtatttgtcaaaggtgtaaaa
cggtcagatcaggaaaaagatgagaacattttcaagaaagccggtaagtctttatttcat
tcaactttcgcattgattgttctatatgttagcacattgtttatctaa

DBGET integrated database retrieval system