KEGG   Bacillus subtilis subsp. subtilis 168: BSU20160Help
Entry
BSU20160          CDS       T00010                                 

Gene name
yosD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939554
NCBI-ProteinID: NP_389898
Pasteur: BG13713
BSORF: BG13713
UniProt: O31885
Position
complement(2168476..2168871)
Genome map
AA seq 131 aa AA seqDB search
MGRHKATIEGLVMKERYYSHRAPGTERWITQPVCKVTRTEPIFEGYIDIEPIEIGGKVYI
PGLNEYVIVTDRQRNIHNEWTYQTDRVIKTIIDEKSLKECEEHNNKKAKNNDTQNQRQIK
TSWWQRLTKKD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgccataaagcaacgattgaaggattggttatgaaagaaaggtattactcacac
cgtgccccaggcacagagaggtggattactcagccagtgtgtaaggtaactcgtactgaa
ccaatcttcgagggctatatagatattgagcctatagaaattggaggtaaagtttatatc
cctggacttaatgaatatgtcatagtgactgacaggcagcgaaacatacataacgagtgg
acatatcaaacagacagagttattaagacaattatagatgaaaaaagcttgaaggaatgc
gaagaacacaataataagaaagcaaaaaacaatgatactcaaaatcaaagacagataaaa
acttcctggtggcagaggctaactaaaaaagactaa

DBGET integrated database retrieval system