KEGG   Bacillus subtilis subsp. subtilis 168: BSU20170Help
Entry
BSU20170          CDS       T00010                                 

Gene name
yosC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939561
NCBI-ProteinID: NP_389899
Pasteur: BG13712
BSORF: BG13712
UniProt: O31886
Position
complement(2168910..2169452)
Genome map
AA seq 180 aa AA seqDB search
MISRASAVYDKLKQAERNIRGDESMQTLDAPIYEVKQESDWYKSEKKRKEDINSFFDKFE
EKYGVKEGFSFYHSEYFGVYEGTEAYEIFKNDIVKNQVDGFYAFKKRSKYFKEIKAMIEQ
IEEVYPFRSHDELGLNNMTGRQWIGDRWFFGVKTEQLVNGDSVVATDYKDYLKIVMEHLD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgatttcccgggcaagcgcagtatacgacaaattaaaacaagcagaaagaaatattagg
ggagatgagagtatgcaaaccttagatgcaccgatttacgaagttaaacaggaaagtgac
tggtataaatctgagaagaaacgcaaagaggatataaactctttctttgataaattcgaa
gaaaagtatggagtcaaggaaggcttctcgttttatcactctgagtactttggagtctac
gaaggaacagaagcgtatgaaatatttaaaaatgacattgttaaaaatcaagtagacgga
ttctatgctttcaaaaaacgatctaaatactttaaagaaataaaagctatgattgagcaa
attgaagaagtgtatccatttaggtctcatgatgagctggggttaaacaacatgactggt
cgtcaatggataggtgacaggtggttctttggagttaaaactgaacagcttgttaatgga
gacagtgtggttgctactgactataaagattatctaaaaattgtaatggagcatttagat
taa

DBGET integrated database retrieval system