KEGG   Bacillus subtilis subsp. subtilis 168: BSU20180Help
Entry
BSU20180          CDS       T00010                                 

Gene name
yosB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939568
NCBI-ProteinID: NP_389900
Pasteur: BG13711
BSORF: BG13711
UniProt: O31887
Position
complement(2169497..2169676)
Genome map
AA seq 59 aa AA seqDB search
MNMFVIAAKSEGKYLYGYHPHIYSNLKQAENALKTMRKNGKLTERDKVYGLDGLMLVDL
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtttgtaattgctgcaaagagtgaagggaaatatctctatggttaccaccca
catatttactcaaatcttaaacaagcagaaaatgcattgaagacaatgagaaaaaacgga
aagttaactgaaagagacaaggtatatggactagacggtctgatgttggtggatctataa

DBGET integrated database retrieval system