KEGG   Bacillus subtilis subsp. subtilis 168: BSU20200Help
Entry
BSU20200          CDS       T00010                                 

Gene name
yorZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-FCS
Motif
Other DBs
NCBI-GeneID: 939577
NCBI-ProteinID: NP_389902
Pasteur: BG13709
BSORF: BG13709
UniProt: O31889
Position
complement(2170030..2170242)
Genome map
AA seq 70 aa AA seqDB search
MNHICDICKEYISGKTICLRISDEKTYVDFNCCESCAKGYSDKVKNECSNLSVKKTLEHL
GLNIKYKIRG
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatatatgtgacatctgtaaggagtacataagcggaaaaacaatttgtcttagg
atcagcgatgaaaaaacttatgtagacttcaactgttgtgaaagttgtgcaaagggttat
tccgataaagtgaaaaatgaatgcagcaatttaagtgttaagaagacattagaacattta
ggattaaatatcaaatacaaaataagaggataa

DBGET integrated database retrieval system