KEGG   Bacillus subtilis subsp. subtilis 168: BSU20210Help
Entry
BSU20210          CDS       T00010                                 

Gene name
yorY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939519
NCBI-ProteinID: NP_389903
Pasteur: BG13708
BSORF: BG13708
UniProt: O31890
Position
complement(2170309..2170491)
Genome map
AA seq 60 aa AA seqDB search
MKDIVRDLVIDDIDAAEGVLDKLYVYLENTLRPEEKRVWERCDKDIMSVFAKLKNIKEII
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
attaaggatattgttagggatcttgtaattgatgatatagatgctgctgaaggagtattg
gataagctttatgtttatttagaaaacactttaaggcctgaagaaaagcgtgtttgggag
cggtgtgataaagatataatgtctgtttttgcaaagctgaaaaatattaaagaaattatt
taa

DBGET integrated database retrieval system