KEGG   Bacillus subtilis subsp. subtilis 168: BSU20220Help
Entry
BSU20220          CDS       T00010                                 

Gene name
yorX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939737
NCBI-ProteinID: NP_389904
Pasteur: BG13707
BSORF: BG13707
UniProt: O31891
Position
complement(2170504..2170731)
Genome map
AA seq 75 aa AA seqDB search
MKKYYVRCKDSKGENASLVIEALSPEHAKEQAYEVYEVGDIYNVSLGEGKSKNCLDRKYS
PYIKNDNGKAITIFS
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagtattatgtaaggtgtaaagacagcaaaggtgaaaatgcgtctctagttatt
gaggcgctatcacctgaacatgcaaaagaacaagcatacgaagtttatgaggtaggggat
atttataatgtaagcctgggagaaggaaagtcgaagaattgcctagaccgaaaatattcc
ccatacataaaaaatgacaatggaaaagcaataaccatattttcatag

DBGET integrated database retrieval system