KEGG   Bacillus subtilis subsp. subtilis 168: BSU20230Help
Entry
BSU20230          CDS       T00010                                 

Gene name
yorW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939522
NCBI-ProteinID: NP_389905
Pasteur: BG13706
BSORF: BG13706
UniProt: O31892
Position
complement(2170771..2171136)
Genome map
AA seq 121 aa AA seqDB search
MLTDQEKIDLVNALDFVVIEPHTQSIYVHNDEKTNGVLAKVLHTISVDEYIESFKKGSLI
DIFPAAMQEAGAEGFKDGQFVIMPKKFYVDQCYAMSKEIERLTNLNNLHNIKPNTYQGLI
H
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgctaactgatcaagaaaaaattgacttggtaaacgctcttgattttgtagttattgaa
ccacatacacaaagcatttacgtacataacgatgaaaagactaatggagtattagctaag
gttttgcacactatttcagtagatgagtatattgagagctttaagaaaggtagtctaatt
gatatctttccagcagcaatgcaagaagccggtgcggaaggatttaaagatggccagttt
gtgattatgccaaagaaattttatgttgatcaatgttatgcgatgagtaaggaaatcgag
cggttaactaacctaaacaatctacacaatattaaaccaaatacatatcaaggcttgatt
cattaa

DBGET integrated database retrieval system