KEGG   Bacillus subtilis subsp. subtilis 168: BSU20240Help
Entry
BSU20240          CDS       T00010                                 

Gene name
yorV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fzo_mitofusin DUF2315
Motif
Other DBs
NCBI-GeneID: 939579
NCBI-ProteinID: NP_389906
Pasteur: BG13705
BSORF: BG13705
UniProt: O31893
Position
complement(2171139..2171357)
Genome map
AA seq 72 aa AA seqDB search
MDSYPESLKKETEEIKERVRNGNIKEDKIKEIAETTVEFLKSEEKRHKYFSEVAAAMADN
LSEFFKSYLKGE
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
ttggatagttacccagagtccctaaaaaaagagacagaggagattaaagagcgtgttagg
aatggaaatatcaaagaagacaagattaaagaaattgcagaaacgacagttgagtttttg
aaatcagaggagaaaagacataaatacttttctgaagttgctgcagctatggctgataac
ttaagtgagtttttcaagtcgtatttaaaaggagagtga

DBGET integrated database retrieval system