KEGG   Bacillus subtilis subsp. subtilis 168: BSU20260Help
Entry
BSU20260          CDS       T00010                                 

Gene name
yorT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939525
NCBI-ProteinID: NP_389908
Pasteur: BG13704
BSORF: BG13704
UniProt: O31894
Position
complement(2172781..2172900)
Genome map
AA seq 39 aa AA seqDB search
MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgttttattaaaagactgtcagcttcttgtgagtcaacaattcatcacaaggta
tatcaaattatgaacgaagcaaaaacagagtttgaaaaagtgctaaagaaattaaaataa

DBGET integrated database retrieval system