KEGG   Bacillus subtilis subsp. subtilis 168: BSU20260
Entry
BSU20260          CDS       T00010                                 

Gene name
yorT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939525
NCBI-ProteinID: NP_389908
Pasteur: BG13704
BSORF: BG13704
UniProt: O31894 A0A6M4JHY9
Position
complement(2172781..2172900)
AA seq 39 aa
MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK
NT seq 120 nt   +upstreamnt  +downstreamnt
gtggaacgttttattaaaagactgtcagcttcttgtgagtcaacaattcatcacaaggta
tatcaaattatgaacgaagcaaaaacagagtttgaaaaagtgctaaagaaattaaaataa

DBGET integrated database retrieval system