KEGG   Bacillus subtilis subsp. subtilis 168: BSU20270Help
Entry
BSU20270          CDS       T00010                                 

Gene name
yorS
Definition
(RefSeq) 5'(3')-deoxyribonucleotidase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NT5C HAD_2
Motif
Other DBs
NCBI-GeneID: 939520
NCBI-ProteinID: NP_389909
Pasteur: BG13703
BSORF: BG13703
UniProt: P68522
Position
complement(2172932..2173450)
Genome map
AA seq 172 aa AA seqDB search
MKKVIAIDMDQVLADLLSDWVAYINTYDDPFLKEKDILCWDIKKYTNTNNNVYRHLDYDL
FRNLNVIEGSQRVTKELMKKYEVYVVTTATNHPDSLKAKLEWLTEYFPFIPHSNVVLCGN
KNIIKADIMIDDGIHNLESFEGMKILFDAPHNRNENRFIRVMNWEEIERKLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaattgcgattgacatggatcaggtcttagctgatttactaagtgattgg
gtagcttacattaacacatacgatgatccttttctcaaagagaaagacatcctatgttgg
gatataaaaaaatatacaaataccaacaataatgtttatagacatttagattacgatttg
ttcagaaatctaaatgttatagaaggtagccaaagagtgacaaaagagctgatgaagaaa
tatgaagtgtatgttgtgactacagcaacaaaccatccagattcccttaaagcaaagctt
gaatggcttacagaatattttccatttattcctcatagcaatgttgtgctttgtggcaat
aaaaacataattaaagcagacatcatgatcgatgatggaatacataacttagaatcattt
gaaggaatgaagatactatttgatgctccccataacaggaatgaaaatagatttattcgt
gttatgaattgggaagagattgaacgaaaattactttaa

DBGET integrated database retrieval system