KEGG   Bacillus subtilis subsp. subtilis 168: BSU20280Help
Entry
BSU20280          CDS       T00010                                 

Gene name
yorR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 Thymidylate_kin dNK AAA_33 AAA_17 AAA_28 SKI Rad17
Motif
Other DBs
NCBI-GeneID: 939530
NCBI-ProteinID: NP_389910
Pasteur: BG13702
BSORF: BG13702
UniProt: O31896
Structure
PDB: 

Position
complement(2173459..2173956)
Genome map
AA seq 165 aa AA seqDB search
MTLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLADEDNVII
DRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDEYI
EGKDIDSILELYREVMSNAGLHTYSWDTGQWSSDEIAKDIIFLVE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacattaattatcttggaggggcctgattgctgctttaaatcaacagttgcagcaaag
ctaagtaaagaactgaagtatccaattatcaaaggttcaagctttgagttggccaaaagc
ggaaatgagaagttatttgaacacttcaataaactagctgatgaagacaacgtgattatt
gacaggtttgtttattctaacttggtatatgcaaagaaattcaaagattactcgatcctt
acagagcgacagcttagatttattgaggataaaattaaagcaaaagcgaaggttgtatac
ttacacgctgatccaagcgttattaagaaaaggttgagggtacgtggagatgagtatata
gagggaaaagacattgattcaattttagagttgtacagagaagttatgagcaatgcggga
ttacatacatattcatgggatactggacaatggtcaagtgacgaaattgctaaagacata
atctttttagtggaatag

DBGET integrated database retrieval system