KEGG   Bacillus subtilis subsp. subtilis 168: BSU20290
Entry
BSU20290          CDS       T00010                                 

Gene name
yorQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Tudor_3
Other DBs
NCBI-GeneID: 939534
NCBI-ProteinID: NP_389911
Pasteur: BG13701
BSORF: BG13701
UniProt: O31897 A0A6M4JKH5
Position
complement(2173956..2174111)
AA seq 51 aa
MFKKGQKVIVDFTDEIGAVAKVDYRYNQIEVKYPDGTYQVVGFHKVRKVED
NT seq 156 nt   +upstreamnt  +downstreamnt
atgtttaaaaaaggtcaaaaggtaattgttgattttacagatgagattggagctgttgcg
aaagttgattatcgatacaaccagatagaagtaaagtatcctgatggcacttaccaggtt
gttggatttcataaagtaaggaaggtggaggattaa

DBGET integrated database retrieval system