KEGG   Bacillus subtilis subsp. subtilis 168: BSU20300Help
Entry
BSU20300          CDS       T00010                                 

Gene name
yorP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YorP
Motif
Other DBs
NCBI-GeneID: 939535
NCBI-ProteinID: NP_389912
Pasteur: BG13700
BSORF: BG13700
UniProt: O31898
Structure
PDB: 

Position
complement(2174104..2174319)
Genome map
AA seq 71 aa AA seqDB search
MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHE
LTPLKGGLAYV
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaatactggagttatcctgttggactagctgtagaaattaacaataatgcacga
tatggatgcccacatcatgtggggagaaaaggaaagattatcgagcatttacattcagct
acatatgactatgcagttagcgatgaaacaggtgacattacttactttaaagaacatgaa
ttaacaccactaaagggaggtttagcttatgtttaa

DBGET integrated database retrieval system