KEGG   Bacillus subtilis subsp. subtilis 168: BSU20320Help
Entry
BSU20320          CDS       T00010                                 

Gene name
yorN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939538
NCBI-ProteinID: NP_389914
Pasteur: BG13698
BSORF: BG13698
UniProt: O31900
Position
complement(2174585..2174734)
Genome map
AA seq 49 aa AA seqDB search
MDKEAKVKSTGERGIIEAIYPETETVELCYYDGTYDERRFDDVVMATSS
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
ttggataaagaggctaaggtaaaatcaactggagagcgtgggattattgaagcgatctat
cctgaaacagaaacagtagaactctgttattatgatggaacttatgatgaaagacgtttt
gatgatgttgttatggcaacaagcagttaa

DBGET integrated database retrieval system