KEGG   Bacillus subtilis subsp. subtilis 168: BSU20330Help
Entry
BSU20330          CDS       T00010                                 

Gene name
yorM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3D LMBR1 RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 939539
NCBI-ProteinID: NP_389915
Pasteur: BG13697
BSORF: BG13697
UniProt: O31901
Position
complement(2174852..2175568)
Genome map
AA seq 238 aa AA seqDB search
MFKKLIDKHKKYVYHRINKMALFATIGLLGVGLVYSAKNLYTHQDNQVSIKKSFYLNKKE
VRQKLIHEIDVPRILPRLKSEEEKQAESRKKYLNATITYLTEENKKAAKHTKTKKVQKTN
TKRNLDKAVSKSTNAKAVKSHEVVATAYTAFCSTGCTGKTRTGYDVSNTSYYNGKRIIAV
DPEVIPLYSLVQVSYEGNSFQAYAIDTGGDIKNNRIDILMDSEQEANAFGRKNVRVSW
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
attttcaaaaaacttatagacaaacataaaaaatatgtatatcatagaattaacaaaatg
gcactttttgctacaattggtttgttaggagtagggctcgtatatagcgctaaaaacttg
tatacacatcaagataatcaagtctcaataaaaaagtcattttatttaaataaaaaagag
gtgaggcaaaaacttattcacgaaattgacgttccaagaatccttcctaggctaaagagt
gaggaagaaaagcaggctgaaagtagaaaaaagtatcttaatgcgacaattacatatcta
acagaagaaaataaaaaagcagcaaaacatacaaaaacaaaaaaagtgcaaaaaaccaat
acaaagagaaatcttgataaagcagtttcaaaaagtacaaatgcaaaggcagtgaagagt
catgaagttgttgctactgcttatactgcgttttgctctacagggtgcacagggaaaaca
agaaccggctacgatgtatcaaacacatcctattacaatggaaaaagaataattgctgtt
gatccagaagtaattcctttgtattcattagtgcaagtttcatatgaaggaaatagcttt
caagcatatgcaatagatacaggaggggacattaaaaacaatcgtattgatattctaatg
gacagtgagcaagaagcaaatgcatttggtcgtaaaaatgtaagagtaagctggtaa

DBGET integrated database retrieval system